Structure of PDB 8agt Chain T

Receptor sequence

>8agtT (length=112) Species: 4932 (Saccharomyces cerevisiae)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 8agt Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
• Chain: T
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	A2 R4 V5 T6 F7 R8 R9 R10 N11 P12 Y13 N14 T15 R16 S17 K24 T25 P26 G27 R31 K36 K37 L38 T40 R41 P42 K43 Q52 G53 I54 S55 T56 R58 P59 R60 Y62 S66 K67 T68 K70 T71 V72 S73 R74 Y76 G78 N83 R91 A92 I95 E96 Q98 K102	A1 R3 V4 T5 F6 R7 R8 R9 N10 P11 Y12 N13 T14 R15 S16 K23 T24 P25 G26 R30 K35 K36 L37 T39 R40 P41 K42 Q51 G52 I53 S54 T55 R57 P58 R59 Y61 S65 K66 T67 K69 T70 V71 S72 R73 Y75 G77 N82 R90 A91 I94 E95 Q97 K101
BS02	ZN	T	C44 C47 C84	C43 C46 C83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8agt, PDBe:8agt, PDBj:8agt
• PDBsum: 8agt
• PubMed: 36804914
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)