Structure of PDB 7y41 Chain T

Receptor sequence

>7y41T (length=114) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

EFPSATAKARYVRVSATKARRVIDLVRGKSVEEALDILRWAPQAASEPVA
KVIASAAANAQNNEGLDPSTLVVATVYADEGPTAKRIRPRAQGRAFRIRK
RTSHITVIVESRPP

3D structure

• PDB: 7y41 Cryo-EM structures reveal a unique conformational dynamics of the Mycobacterium 23S rRNA helices
• Chain: T
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	K13 A14 R15 Y16 R18 S20 T22 K23 R25 R32 P47 A49 K56 A63 N64 N67 N68 D84 E85 K90 R91 R93 P94 R95 A96 Q97 G98 R99 A100 F101 R102 I103 R104 K105 R106	K8 A9 R10 Y11 R13 S15 T17 K18 R20 R27 P42 A44 K51 A58 N59 N62 N63 D79 E80 K85 R86 R88 P89 R90 A91 Q92 G93 R94 A95 F96 R97 I98 R99 K100 R101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7y41, PDBe:7y41, PDBj:7y41
• PDBsum: 7y41
• PubMed: 37709237
• UniProt: A0QSD6|RL22_MYCS2 Large ribosomal subunit protein uL22 (Gene Name=rplV)