Structure of PDB 7w1o Chain T |
>7w1oT (length=96) Species: 9823 (Sus scrofa) [Search protein sequence] |
GVRTSPTGEKVTHTGQAYDDGDYRRVRFSDRQKEVNENFAIDLIAEQPVS EVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQPHH |
|
PDB | 7w1o The coupling mechanism of mammalian mitochondrial complex I. |
Chain | T |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
T |
H95 C111 C114 |
H68 C84 C87 |
|
|
|
|