Structure of PDB 7v2q Chain T

Receptor sequence
>7v2qT (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
3D structure
PDB7v2q Decoding the Mechanism of Specific RNA Targeting by Ribosomal Methyltransferases.
ChainT
Resolution3.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T L10 K14 R15 H16 R17 R22 R23 N26 K29 R57 E60 S61 D64 K65 K68 S70 H73 K74 N75 R79 K81 S82 R83 M85 R86 R89 G101 G102 G103 S105 L3 K7 R8 H9 R10 R15 R16 N19 K22 R50 E53 S54 D57 K58 K61 S63 H66 K67 N68 R72 K74 S75 R76 M78 R79 R82 G94 G95 G96 S98
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v2q, PDBe:7v2q, PDBj:7v2q
PDBsum7v2q
PubMed35316014
UniProtP80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]