Structure of PDB 7v2h Chain T |
>7v2hT (length=96) Species: 9823 (Sus scrofa) [Search protein sequence] |
GVRTSPTGEKVTHTGQAYDDGDYRRVRFSDRQKEVNENFAIDLIAEQPVS EVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQPHH |
|
PDB | 7v2h The coupling mechanism of mammalian mitochondrial complex I. |
Chain | T |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
T |
C86 H95 C111 |
C59 H68 C84 |
|
|
|
|