Structure of PDB 7unr Chain T

Receptor sequence
>7unrT (length=103) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
MYAVIVTGGKQHKVTEGEFLKVEKLDVATGEAIDFDRVLLVANGEDVKIG
LPVVEGAKVTAEVVSHGRHDKVRIIKFRRRKHHMKRQGHRQWFTEIKITG
IQA
3D structure
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
ChainT
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T G8 K10 F19 R68 K71 K76 F77 R78 R79 R80 K81 H83 K85 R86 G88 H89 G8 K10 F19 R68 K71 K76 F77 R78 R79 R80 K81 H83 K85 R86 G88 H89
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9HVL6|RL21_PSEAE Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]