Structure of PDB 7uik Chain T

Receptor sequence
>7uikT (length=89) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGL
3D structure
PDB7uik Structural basis of a transcription pre-initiation complex on a divergent promoter.
ChainT
Resolution7.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna T K17 K18 L49 T50 R51 K10 K11 L42 T43 R44
BS02 dna T Q9 A10 R15 K18 K20 C21 K23 L49 Q2 A3 R8 K11 K13 C14 K16 L42
BS03 ZN T C11 C14 C21 C4 C7 C14
BS04 ZN T C11 C31 C38 C4 C24 C31
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uik, PDBe:7uik, PDBj:7uik
PDBsum7uik
PubMed36731470
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]