Structure of PDB 7rje Chain T

Receptor sequence

>7rjeT (length=384) Species: 237561 (Candida albicans SC5314)

MPTRKSNTYLSLVNSYLIDSPQPSSINYWWNLGSLLGLCLVIQIASGVFL
AMHYSSNIELAFDSVEHIMRDVNAGWLIRYIHANGASFFFICMYLHIGKA
LYYGSYKQPRVMLWVIGVVIFILTMAIAFMGYCLVYGQMSHWGATVITNL
LSAIPFIGNDIVPFIWGGFSVSNPTIQRFFALHFLLPFILAALVCMHLMA
LHVHGSSNPVGITGNIDRLPMHPYFIFKDLITVFVFLLIFSLFVFYSPNT
LGHPDNYIPGNPMVTPPSIVPEWYLLPFYAILRSIPDKLGGVIAMFGAIL
ILLSLPYTDRSIIRGNSFKVLSKLAFYLFVFNFILLGNLGQLHVEVPYIQ
LGQFATAYYFAHYIIVVPVISTLENILYYIGTQT

3D structure

• PDB: 7rje Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
• Chain: T
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	T	Q43 G47 V48 V65 R79 H82 A83 A86 G131 Y132 L134 V135 H183 F184	Q43 G47 V48 V65 R79 H82 A83 A86 G131 Y132 L134 V135 H183 F184
BS02	HEM	T	W30 G33 L36 M93 H96 K99 S105 R110 L113 W114 G117 I120 V194 H197 L201 S206 S207	W30 G33 L36 M93 H96 K99 S105 R110 L113 W114 G117 I120 V194 H197 L201 S206 S207
BS03	ZL5	T	M125 A128 F129 Y132 M139 G143 I147 V270 P271 E272 Y274 L275 Y279 M295	M125 A128 F129 Y132 M139 G143 I147 V270 P271 E272 Y274 L275 Y279 M295

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0000792 heterochromatin
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:7rje, PDBe:7rje, PDBj:7rje
• PDBsum: 7rje
• PubMed: 34525326
• UniProt: P0C8L0|CYB_CANAL Cytochrome b (Gene Name=COB)