Structure of PDB 7r5s Chain T |
>7r5sT (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
RPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCLDKYFQHLCDDLE VFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQLLIP CAYSGNSVFPAQ |
|
PDB | 7r5s Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome. |
Chain | T |
Resolution | 2.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
T |
P451 Q453 |
P2 Q4 |
|
|
|
|