Structure of PDB 7qgg Chain T

Receptor sequence

>7qggT (length=176) Species: 10116 (Rattus norvegicus)

MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQ
LKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDL
TTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSKI
KFPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

• PDB: 7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
• Chain: T
• Resolution: 2.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	S42 R43 Y46 S49 K53 K55 K56 S57 R120 H122	S42 R43 Y46 S49 K53 K55 K56 S57 R120 H122
BS02	rna	T	K2 S4 G5 H23 Y63 V67 F68 K70 P72 R87 H91 M93 Y94 R95 R98 R111 G114 A115 R116 H117 R118 R120 R139 H146 D147 S148 H156 L159 R160 Q162 H163 K164 R166 T169 K170 R171 P172 N173 T174 F175 F176	K2 S4 G5 H23 Y63 V67 F68 K70 P72 R87 H91 M93 Y94 R95 R98 R111 G114 A115 R116 H117 R118 R120 R139 H146 D147 S148 H156 L159 R160 Q162 H163 K164 R166 T169 K170 R171 P172 N173 T174 F175 F176

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0097327 response to antineoplastic agent

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0014069 postsynaptic density
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
• PDBsum: 7qgg
• PubMed: 36038000
• UniProt: P62718|RL18A_RAT Large ribosomal subunit protein eL20 (Gene Name=Rpl18a)