Structure of PDB 7pir Chain T

Receptor sequence

>7pirT (length=53) Species: 272634 (Mycoplasmoides pneumoniae M129)

EVKNDDLELALKKFKRVSLEIRRLAQRHEYHLRKGMRLREKRKIAQKKRR
KFR

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: T
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	L28 H32 H35 R37 K38 G39 M40 R43 K45 R46 A49 Q50 K51 R54 K55	L24 H28 H31 R33 K34 G35 M36 R39 K41 R42 A45 Q46 K47 R50 K51

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: P57079|RS21_MYCPN Small ribosomal subunit protein bS21 (Gene Name=rpsU)