Structure of PDB 7pai Chain T

Receptor sequence

>7paiT (length=53) Species: 272634 (Mycoplasmoides pneumoniae M129)

EVKNDDLELALKKFKRVSLEIRRLAQRHEYHLRKGMRLREKRKIAQKKRR
KFR

3D structure

• PDB: 7pai Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: T
• Resolution: 6.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	R37 R43 R53	R33 R39 R49

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pai, PDBe:7pai, PDBj:7pai
• PDBsum: 7pai
• PubMed: 36171285
• UniProt: P57079|RS21_MYCPN Small ribosomal subunit protein bS21 (Gene Name=rpsU)