Structure of PDB 7oib Chain T

Receptor sequence
>7oibT (length=159) Species: 9606 (Homo sapiens) [Search protein sequence]
ISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRG
MSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST
SGRGQCLKRIRGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQL
RSRTIVHTL
3D structure
PDB7oib A distinct assembly pathway of the human 39S late pre-mitoribosome.
ChainT
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T I47 S48 R49 K50 W51 R78 K81 Y82 S83 K86 W88 R95 D110 K111 R149 K154 M167 E168 K169 V170 H173 F175 S205 R206 V209 H210 I1 S2 R3 K4 W5 R32 K35 Y36 S37 K40 W42 R49 D64 K65 R103 K108 M114 E115 K116 V117 H120 F122 S152 R153 V156 H157
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oib, PDBe:7oib, PDBj:7oib
PDBsum7oib
PubMed34315873
UniProtQ9NWU5|RM22_HUMAN Large ribosomal subunit protein uL22m (Gene Name=MRPL22)

[Back to BioLiP]