Structure of PDB 7oe0 Chain T

Receptor sequence

>7oe0T (length=85) Species: 679895 (Escherichia coli BW25113)

NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

• PDB: 7oe0 RbfA Is Involved in Two Important Stages of 30S Subunit Assembly: Formation of the Central Pseudoknot and Docking of Helix 44 to the Decoding Center.
• Chain: T
• Resolution: 2.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	N2 I3 K4 S5 K8 R9 S13 R17 H19 N20 S22 S25 M26 R28 T29 K32 K33 Y35 Q54 P55 D58 R59 A62 K63 H67 K68 N69 K70 A72 R73 K75 A76 T79 K84	N1 I2 K3 S4 K7 R8 S12 R16 H18 N19 S21 S24 M25 R27 T28 K31 K32 Y34 Q53 P54 D57 R58 A61 K62 H66 K67 N68 K69 A71 R72 K74 A75 T78 K83

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008073 ornithine decarboxylase inhibitor activity
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oe0, PDBe:7oe0, PDBj:7oe0
• PDBsum: 7oe0
• PubMed: 34200244
• UniProt: P0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)