Structure of PDB 7nhl Chain T

Receptor sequence

>7nhlT (length=116) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

PRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRR
QRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAIS
DEKAFAQLVTKAKDAL

3D structure

• PDB: 7nhl Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Chain: T
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	P2 R3 V4 K5 G6 T8 T10 R11 R13 R14 K15 K16 G23 Y24 F25 G26 S27 K28 H29 K33 K36 Q37 Q38 K41 S42 Y45 A46 F47 R48 D49 R50 R51 Q52 R53 K54 R55 F57 R58 K59 W61 I62 N66 R70 S75 S77 N81 K84 N91 R92 K93	P1 R2 V3 K4 G5 T7 T9 R10 R12 R13 K14 K15 G22 Y23 F24 G25 S26 K27 H28 K32 K35 Q36 Q37 K40 S41 Y44 A45 F46 R47 D48 R49 R50 Q51 R52 K53 R54 F56 R57 K58 W60 I61 N65 R69 S74 S76 N80 K83 N90 R91 K92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhl, PDBe:7nhl, PDBj:7nhl
• PDBsum: 7nhl
• PubMed: 34117249
• UniProt: Q2FXQ1|RL20_STAA8 Large ribosomal subunit protein bL20 (Gene Name=rplT)