Structure of PDB 7dui Chain T

Receptor sequence

>7duiT (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

PDB

7dui Crystal structure of the Thermus thermophilus (HB8) 30S ribosomal subunit with mRNA and cognate transfer RNA anticodon stem-loop and sisomicin derivative N1''PyrS bound

Chain

Resolution

3.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	L10 K14 R15 H16 R17 S19 R22 R23 R25 N26 K27 K29 S31 T35 L36 K38 K39 E60 S61 D64 K65 K68 S70 K74 N75 A76 A78 R79 K81 S82 R83 M85 R86 R89 G102 G103 L104 S105	L3 K7 R8 H9 R10 S12 R15 R16 R18 N19 K20 K22 S24 T28 L29 K31 K32 E53 S54 D57 K58 K61 S63 K67 N68 A69 A71 R72 K74 S75 R76 M78 R79 R82 G95 G96 L97 S98

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7dui, PDBe:7dui, PDBj:7dui
PDBsum	7dui
PubMed
UniProt	P80380\|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]