Structure of PDB 7bod Chain T

Receptor sequence

>7bodT (length=86) Species: 83333 (Escherichia coli K-12)

ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

• PDB: 7bod A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit.
• Chain: T
• Resolution: 2.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	A2 N3 I4 S6 K9 R10 S14 R18 H20 N21 S23 R24 R25 S26 M27 R29 T30 K33 K34 Y36 Q55 P56 D59 R60 K64 H68 K69 N70 K71 A73 R74 K76 A77 T80 Q82	A1 N2 I3 S5 K8 R9 S13 R17 H19 N20 S22 R23 R24 S25 M26 R28 T29 K32 K33 Y35 Q54 P55 D58 R59 K63 H67 K68 N69 K70 A72 R73 K75 A76 T79 Q81

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008073 ornithine decarboxylase inhibitor activity
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7bod, PDBe:7bod, PDBj:7bod
• PDBsum: 7bod
• PubMed: 34088665
• UniProt: P0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)