Structure of PDB 6za9 Chain T |
>6za9T (length=70) Species: 9940 (Ovis aries) [Search protein sequence] |
VPPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKR DEQKRIERELAEAQEDTILK |
|
PDB | 6za9 Cryo-EM structure of the entire mammalian F-type ATP synthase. |
Chain | T |
Resolution | 3.76 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
S12 |
T |
L70 K71 |
L69 K70 |
|
|
|
|