Structure of PDB 6ywe Chain T

Receptor sequence
>6yweT (length=180) Species: 5141 (Neurospora crassa) [Search protein sequence]
KRHKYPTARVTRDNSKQRGESALRKSGTRWKLSVSDEPLPEPVPREELPP
IQVDENHGLWDFFYDRETVAMAPLEHTKHGRAWTVSELRKKSWDDLHRLW
WVCVKERNRIATANWERTKSELGFGLAEANERDRNVKQTMRGIKHVLTER
FYAWEDAVKLAEQDPEIDLSNPENPYTPST
3D structure
PDB6ywe Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
ChainT
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna T K44 R45 H46 Y48 T50 R52 T54 R55 N57 S58 R61 G62 E63 S64 R67 T71 W73 K74 S78 R132 W158 E174 R177 Q181 R184 K187 H188 T191 Y195 K1 R2 H3 Y5 T7 R9 T11 R12 N14 S15 R18 G19 E20 S21 R24 T28 W30 K31 S35 R89 W115 E131 R134 Q138 R141 K144 H145 T148 Y152
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Mar 10 06:36:40 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ywe', asym_id = 'T', title = 'Analysis of translating mitoribosome reveals fun...eristics of translation in mitochondria of fungi.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ywe', asym_id='T', title='Analysis of translating mitoribosome reveals fun...eristics of translation in mitochondria of fungi.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005761,0006412', uniprot = '', pdbid = '6ywe', asym_id = 'T'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005761,0006412', uniprot='', pdbid='6ywe', asym_id='T')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>