Structure of PDB 6yef Chain T

Receptor sequence

>6yefT (length=116) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

PRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRR
QRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAIS
DEKAFAQLVTKAKDAL

3D structure

PDB

6yef Cryo-EM structure of the ribosome functional complex of the human pathogen Staphylococcus aureus at 3.2 angstrom resolution.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	P2 R3 V4 K5 R11 R13 R14 K22 G23 Y24 F25 G26 S27 T30 K33 K36 Q37 Q38 K41 S42 Y45 A46 F47 R48 D49 R50 R51 R53 K54 R55 F57 R58 K59 N66 Y76 S77 N81 K84 N91 R92 K93	P1 R2 V3 K4 R10 R12 R13 K21 G22 Y23 F24 G25 S26 T29 K32 K35 Q36 Q37 K40 S41 Y44 A45 F46 R47 D48 R49 R50 R52 K53 R54 F56 R57 K58 N65 Y75 S76 N80 K83 N90 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6yef, PDBe:6yef, PDBj:6yef
PDBsum	6yef
PubMed	32852796
UniProt	Q2FXQ1\|RL20_STAA8 Large ribosomal subunit protein bL20 (Gene Name=rplT)