Structure of PDB 6y7c Chain T

Receptor sequence

>6y7cT (length=143) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

PDB

6y7c Good Vibrations: Structural Remodeling of Maturing Yeast Pre-40S Ribosomal Particles Followed by Cryo-Electron Microscopy.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	R7 A11 Q12 I15 Y33 V37 K38 T39 S41 G42 N43 M45 P47 Q48 R57 S60 H64 R68 Q70 V73 K75 K78 L79 Y80 G81 G82 A83 S85 R86 G87 V88 R89 P90 Y91 D95 A96 S97 G98 S99 R102 Q106 K119 G120 G121 Q129	R6 A10 Q11 I14 Y32 V36 K37 T38 S40 G41 N42 M44 P46 Q47 R56 S59 H63 R67 Q69 V72 K74 K77 L78 Y79 G80 G81 A82 S84 R85 G86 V87 R88 P89 Y90 D94 A95 S96 G97 S98 R101 Q105 K118 G119 G120 Q128

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0006412	translation
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6y7c, PDBe:6y7c, PDBj:6y7c
PDBsum	6y7c
PubMed	32138239
UniProt	P07280\|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)