Structure of PDB 6wu9 Chain T

Receptor sequence
>6wu9T (length=112) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]
QITSAKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIE
KVLMSAVANAENNFDLDVESLVVSEAFVNEGPTMKRFRPRAKGSASPINK
RTSHITVVVTEK
3D structure
PDB6wu9 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
ChainT
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna T T11 K13 R16 R20 K21 N46 K47 K54 A61 N62 N65 N66 N82 E83 R89 R91 P92 R93 A94 K95 G96 S97 S99 P100 I101 N102 H107 T8 K10 R13 R17 K18 N43 K44 K51 A58 N59 N62 N63 N79 E80 R86 R88 P89 R90 A91 K92 G93 S94 S96 P97 I98 N99 H104
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6wu9, PDBe:6wu9, PDBj:6wu9
PDBsum6wu9
PubMed33004869
UniProtQ839F9|RL22_ENTFA Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]