Structure of PDB 6wm2 Chain T

Receptor sequence

>6wm2T (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]

CCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGP
QNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLN

3D structure

PDB

6wm2 Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	WSS	T	W60 F71 S76	W16 F27 S32

Gene Ontology

	Biological Process
GO:0006897	endocytosis
GO:0006898	receptor-mediated endocytosis
GO:0007035	vacuolar acidification
GO:0007042	lysosomal lumen acidification
GO:0019065	receptor-mediated endocytosis of virus by host cell
GO:0048388	endosomal lumen acidification
GO:0051452	intracellular pH reduction
GO:0061795	Golgi lumen acidification
GO:0090304	nucleic acid metabolic process
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0000139	Golgi membrane
GO:0000220	vacuolar proton-transporting V-type ATPase, V0 domain
GO:0005765	lysosomal membrane
GO:0005886	plasma membrane
GO:0010008	endosome membrane
GO:0012505	endomembrane system
GO:0016020	membrane
GO:0030665	clathrin-coated vesicle membrane
GO:0031410	cytoplasmic vesicle
GO:0033176	proton-transporting V-type ATPase complex

External links

PDB	RCSB:6wm2, PDBe:6wm2, PDBj:6wm2
PDBsum	6wm2
PubMed	33065002
UniProt	Q6P5S7\|RNK_HUMAN Ribonuclease kappa (Gene Name=RNASEK)