Structure of PDB 6wdr Chain T

Receptor sequence

>6wdrT (length=143) Species: 559292 (Saccharomyces cerevisiae S288C)

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

• PDB: 6wdr An open interface in the pre-80S ribosome coordinated by ribosome assembly factors Tsr1 and Dim1 enables temporal regulation of Fap7.
• Chain: T
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	P2 G3 R7 Q12 V37 S41 N43 E44 P47 Q48 R57 H64 R68 K69 G72 V73 G74 K75 K78 G82 R86 G87 V88 R89 P90 S97 S99 R102 Q106 K119 R122 E126 Q129 R130 D133 R134	P1 G2 R6 Q11 V36 S40 N42 E43 P46 Q47 R56 H63 R67 K68 G71 V72 G73 K74 K77 G81 R85 G86 V87 R88 P89 S96 S98 R101 Q105 K118 R121 E125 Q128 R129 D132 R133

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0006412 translation
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6wdr, PDBe:6wdr, PDBj:6wdr
• PDBsum: 6wdr
• PubMed: 33219089
• UniProt: P07280|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)