Structure of PDB 6wd8 Chain T

Receptor sequence
>6wd8T (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB6wd8 Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.
ChainT
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna T S1 T4 N19 D20 T21 G22 S23 Q27 L30 H37 L38 H41 H45 K47 D48 H49 H50 S51 R53 S60 Q61 K64 L65 Y68 S1 T4 N19 D20 T21 G22 S23 Q27 L30 H37 L38 H41 H45 K47 D48 H49 H50 S51 R53 S60 Q61 K64 L65 Y68
BS02 rna T L55 L56 V59 L55 L56 V59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6wd8, PDBe:6wd8, PDBj:6wd8
PDBsum6wd8
PubMed32612237
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]