Structure of PDB 6ttu Chain T

Receptor sequence
>6ttuT (length=394) Species: 9606 (Homo sapiens) [Search protein sequence]
DFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKL
IERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWR
CGRHSLQRIHCRSEKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRIL
TGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHL
RFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYI
VSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIR
LWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDP
RAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFL
3D structure
PDB6ttu NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
ChainT
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide T Y307 R321 S345 L347 L387 R557 Y118 R132 S156 L158 L198 R368
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008013 beta-catenin binding
GO:0016874 ligase activity
GO:0045309 protein phosphorylated amino acid binding
GO:0046983 protein dimerization activity
GO:0061630 ubiquitin protein ligase activity
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
GO:1990757 ubiquitin ligase activator activity
Biological Process
GO:0000209 protein polyubiquitination
GO:0006470 protein dephosphorylation
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007165 signal transduction
GO:0016055 Wnt signaling pathway
GO:0016567 protein ubiquitination
GO:0030163 protein catabolic process
GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0031648 protein destabilization
GO:0033598 mammary gland epithelial cell proliferation
GO:0038061 non-canonical NF-kappaB signal transduction
GO:0042752 regulation of circadian rhythm
GO:0042753 positive regulation of circadian rhythm
GO:0043122 regulation of canonical NF-kappaB signal transduction
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045862 positive regulation of proteolysis
GO:0045879 negative regulation of smoothened signaling pathway
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0048511 rhythmic process
GO:0050860 negative regulation of T cell receptor signaling pathway
GO:0051726 regulation of cell cycle
GO:0060444 branching involved in mammary gland duct morphogenesis
GO:0060828 regulation of canonical Wnt signaling pathway
GO:0061136 regulation of proteasomal protein catabolic process
GO:0070936 protein K48-linked ubiquitination
GO:0071407 cellular response to organic cyclic compound
GO:1904668 positive regulation of ubiquitin protein ligase activity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0019005 SCF ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ttu, PDBe:6ttu, PDBj:6ttu
PDBsum6ttu
PubMed32051583
UniProtQ9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A (Gene Name=BTRC)

[Back to BioLiP]