Structure of PDB 6sj6 Chain T

Receptor sequence
>6sj6T (length=116) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
PRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRR
QRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAIS
DEKAFAQLVTKAKDAL
3D structure
PDB6sj6 Mechanism of ribosome shutdown by RsfS in Staphylococcus aureus revealed by integrative structural biology approach.
ChainT
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T P2 R3 T8 R13 R14 K15 K19 G23 Y24 F25 G26 H29 K33 Q37 Q38 Y45 R48 D49 R50 R51 R53 R55 R58 K59 N66 K93 P1 R2 T7 R12 R13 K14 K18 G22 Y23 F24 G25 H28 K32 Q36 Q37 Y44 R47 D48 R49 R50 R52 R54 R57 K58 N65 K92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sj6, PDBe:6sj6, PDBj:6sj6
PDBsum6sj6
PubMed32245971
UniProtQ2FXQ1|RL20_STAA8 Large ribosomal subunit protein bL20 (Gene Name=rplT)

[Back to BioLiP]