Structure of PDB 6pgk Chain T

Receptor sequence
>6pgkT (length=46) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ILCNLFAIALGRYIQSRGKGPGLGLPELLATTSFGHLLAAGVVSGL
3D structure
PDB6pgk Membrane protein megahertz crystallography at the European XFEL.
ChainT
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA T Q35 R37 Q15 R17
BS02 CLA T I20 H67 I1 H36
BS03 CLA T L68 L69 G72 G76 L37 L38 G41 G45
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pgk, PDBe:6pgk, PDBj:6pgk
PDBsum6pgk
PubMed31685819
UniProtP0A425|PSAK_THEVB Photosystem I reaction center subunit PsaK (Gene Name=psaK)

[Back to BioLiP]