Structure of PDB 6n8k Chain T

Receptor sequence
>6n8kT (length=61) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IKHSKCRQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEG
NVPQTLAPVPY
3D structure
PDB6n8k Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
ChainT
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T F105 R108 V109 N112 R116 K120 L128 K129 R130 F10 R13 V14 N17 R21 K25 L33 K34 R35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8k, PDBe:6n8k, PDBj:6n8k
PDBsum6n8k
PubMed30814529
UniProtQ02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]