Structure of PDB 6ha8 Chain T

Receptor sequence
>6ha8T (length=90) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKV
DKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIE
3D structure
PDB6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
ChainT
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T T14 R16 K25 R33 N35 K36 T37 E38 K53 N55 I56 M57 N58 Y59 K60 K62 K64 R65 V66 R68 Y69 G71 M72 S74 R75 R77 K82 T13 R15 K24 R32 N34 K35 T36 E37 K52 N54 I55 M56 N57 Y58 K59 K61 K63 R64 V65 R67 Y68 G70 M71 S73 R74 R76 K81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
PDBsum6ha8
PubMed30126986
UniProtP42924|RL23_BACSU Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]