Structure of PDB 6gq1 Chain T

Receptor sequence

>6gq1T (length=159) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

PDB

6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.

Chain

Resolution

4.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	G2 K3 S4 H5 G6 Y7 R8 S9 R12 Y13 F15 Q16 R17 F19 H22 K35 D41 K43 G46 Q49 K50 H54 K55 F56 Y57 Q58 G59 K60 T61 T68 K69 S71 K78 K87 R88 K100 E104 R108 V109 R116 Q127 L128 K129 R130 P132	G1 K2 S3 H4 G5 Y6 R7 S8 R11 Y12 F14 Q15 R16 F18 H21 K34 D40 K42 G45 Q48 K49 H53 K54 F55 Y56 Q57 G58 K59 T60 T67 K68 S70 K77 K86 R87 K99 E103 R107 V108 R115 Q126 L127 K128 R129 P131
BS02	rna	T	H26 L27 S28	H25 L26 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
PDBsum	6gq1
PubMed	29886014
UniProt	Q02753\|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]