Structure of PDB 6g7r Chain T

Receptor sequence
>6g7rT (length=263) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
PRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGT
QAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAA
GASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPD
VMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQS
WDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAE
NGFWDRGSFYSRV
3D structure
PDB6g7r Mechanistic Exploitation of a Self-Repairing, Blocked Proton Transfer Pathway in an O2-Tolerant [NiFe]-Hydrogenase.
ChainT
Resolution1.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C17 C20 C115 C149 H187 C190 C215 C221 C230 P242 C249 C252
Catalytic site (residue number reindexed from 1) C13 C16 C111 C145 H183 C186 C211 C217 C226 P238 C245 C248
Enzyme Commision number 1.12.99.6: hydrogenase (acceptor).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 T H187 C190 R192 R193 C215 L216 Y217 C221 P224 I243 H183 C186 R188 R189 C211 L212 Y213 C217 P220 I239
BS02 F3S T N228 C230 W235 P242 C249 L250 C252 N224 C226 W231 P238 C245 L246 C248
BS03 SF3 T C17 C19 C20 C115 C120 C149 C13 C15 C16 C111 C116 C145
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008901 ferredoxin hydrogenase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0033748 hydrogenase (acceptor) activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006113 fermentation
GO:0009061 anaerobic respiration
GO:0009267 cellular response to starvation
GO:0019645 anaerobic electron transport chain
GO:1902421 hydrogen metabolic process
Cellular Component
GO:0005886 plasma membrane
GO:0009375 ferredoxin hydrogenase complex
GO:0016020 membrane
GO:0044569 [Ni-Fe] hydrogenase complex
GO:0098567 periplasmic side of plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6g7r, PDBe:6g7r, PDBj:6g7r
PDBsum6g7r
PubMed30070475
UniProtP69739|MBHS_ECOLI Hydrogenase-1 small chain (Gene Name=hyaA)

[Back to BioLiP]