Structure of PDB 5v7q Chain T

Receptor sequence
>5v7qT (length=98) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
TLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIAVEKIFAV
KVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
ChainT
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T S17 E18 K19 L23 R34 K39 T40 Q41 K43 N58 T59 N61 R62 K65 R66 K67 T69 R70 T71 R76 K77 R81 I83 S15 E16 K17 L21 R32 K37 T38 Q39 K41 N56 T57 N59 R60 K63 R64 K65 T67 R68 T69 R74 K75 R79 I81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WHB9|RL23_MYCTU Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]