Structure of PDB 5jbh Chain T

Receptor sequence
>5jbhT (length=111) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
FRYRGYTLEQLMNMSLEELARLFPARQRRSLKRGLTPEQKKLLRKIRLAK
KGKYKKPIRTHCRDMIILPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGE
FAPTRKKVEHG
3D structure
PDB5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
ChainT
Resolution5.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T F28 P29 A30 R33 R34 S35 R38 E43 K46 R49 K50 Y59 K61 R64 T65 H66 R68 D69 G86 K87 Y102 G104 T109 K111 V113 G116 F23 P24 A25 R28 R29 S30 R33 E38 K41 R44 K45 Y54 K56 R59 T60 H61 R63 D64 G81 K82 Y97 G99 T104 K106 V108 G111
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum5jbh
PubMed27819266
UniProtQ8U002|RS19_PYRFU Small ribosomal subunit protein uS19 (Gene Name=rps19)

[Back to BioLiP]