Structure of PDB 4ox9 Chain T

Receptor sequence
>4ox9T (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
3D structure
PDB4ox9 Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
ChainT
Resolution3.8035 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T L10 K14 R15 H16 R17 S19 R22 R23 K27 A28 K29 S31 A32 T35 K38 E60 S61 D64 K65 K68 S70 K74 N75 A78 R79 K81 S82 M85 R86 G102 S105 L3 K7 R8 H9 R10 S12 R15 R16 K20 A21 K22 S24 A25 T28 K31 E53 S54 D57 K58 K61 S63 K67 N68 A71 R72 K74 S75 M78 R79 G95 S98
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ox9, PDBe:4ox9, PDBj:4ox9
PDBsum4ox9
PubMed24717845
UniProtP80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]