Structure of PDB 4kzx Chain T

Receptor sequence

>4kzxT (length=141) Species: 9986 (Oryctolagus cuniculus)

VTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWF
YTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRV
LQALEGLKMVEKDQDWGRKLTPQGQRDLDRIAGQVAAAKKK

3D structure

• PDB: 4kzx The initiation of mammalian protein synthesis and mRNA scanning mechanism.
• Chain: T
• Resolution: 7.809 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	V4 K7 Q11 Q12 K41 E44 Y48 R62 H63 G71 G73 S74 Y79 R82 R84 G86 V87 M88 P89 S90 H91 F92 K97 S98 R101 R102 Q105 W119 G120 R121 P125 R129 D132 R133	V1 K4 Q8 Q9 K38 E41 Y45 R59 H60 G68 G70 S71 Y76 R79 R81 G83 V84 M85 P86 S87 H88 F89 K94 S95 R98 R99 Q102 W116 G117 R118 P122 R126 D129 R130

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4kzx, PDBe:4kzx, PDBj:4kzx
• PDBsum: 4kzx
• PubMed: 23873042
• UniProt: G1TN62|RS19_RABIT Small ribosomal subunit protein eS19 (Gene Name=RPS19)