Structure of PDB 4ko2 Chain T

Receptor sequence

>4ko2T (length=279) Species: 899 (Desulfomicrobium baculatum)

AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEG
EMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEV
TMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKI
EKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFG
DNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNG
INWCVENAVCIGCVEPDFPDGKSPFYVAE

3D structure

• PDB: 4ko2 Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
• Chain: T
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 1.12.99.6: hydrogenase (acceptor).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	T	H208 C211 Y213 L214 Y217 C231 K232 A233 C237 P240 V259	H204 C207 Y209 L210 Y213 C227 K228 A229 C233 P236 V255
BS02	SF4	T	C246 W251 C258 C264 I265 G266 C267	C242 W247 C254 C260 I261 G262 C263
BS03	SF4	T	C18 G20 C21 G124 C126 C164 P165	C14 G16 C17 G120 C122 C160 P161
BS04	CA	T	D271 G275	D267 G271
BS05	CA	T	D195 D196	D191 D192

Gene Ontology

Molecular Function

• GO:0008901 ferredoxin hydrogenase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0033748 hydrogenase (acceptor) activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0009375 ferredoxin hydrogenase complex
• GO:0016020 membrane
• GO:0042597 periplasmic space
• GO:0044569 [Ni-Fe] hydrogenase complex

External links

• PDB: RCSB:4ko2, PDBe:4ko2, PDBj:4ko2
• PDBsum: 4ko2
• PubMed: 23811828
• UniProt: P13063|PHSS_DESBA Periplasmic [NiFeSe] hydrogenase small subunit