Structure of PDB 4ioa Chain T

Receptor sequence
>4ioaT (length=84) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGV
GMGRDHTLFALSDGKVVFINKGKGARFISIEAAQ
3D structure
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainT
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T S9 D15 S16 N17 P18 K19 Y20 V23 K24 F26 G27 E29 K32 A33 G34 N35 I36 R39 R41 G42 T43 K44 K46 G54 R55 D56 H57 T58 F60 F69 R77 S8 D14 S15 N16 P17 K18 Y19 V22 K23 F25 G26 E28 K31 A32 G33 N34 I35 R38 R40 G41 T42 K43 K45 G53 R54 D55 H56 T57 F59 F68 R76
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RY65|RL27_DEIRA Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]