Structure of PDB 3pio Chain T

Receptor sequence
>3pioT (length=74) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
NGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFA
LSDGKVVFINKGKGARFISIEAAQ
3D structure
PDB3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
ChainT
Resolution3.2473 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T N12 R14 D15 N17 P18 K19 Y20 V23 K24 F26 G27 E29 A33 G34 N35 I36 R39 R41 G42 T43 F45 R55 D56 F60 F69 R77 N1 R3 D4 N6 P7 K8 Y9 V12 K13 F15 G16 E18 A22 G23 N24 I25 R28 R30 G31 T32 F34 R44 D45 F49 F58 R66
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum3pio
PubMed21282615
UniProtQ9RY65|RL27_DEIRA Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]