Structure of PDB 2zjp Chain T

Receptor sequence
>2zjpT (length=84) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGV
GMGRDHTLFALSDGKVVFINKGKGARFISIEAAQ
3D structure
PDB2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
ChainT
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T S9 R14 N17 P18 K19 Y20 K24 F26 G27 E29 A33 G34 N35 I36 R39 R41 G42 T43 K44 F45 G54 R55 D56 F60 L62 F69 R77 S8 R13 N16 P17 K18 Y19 K23 F25 G26 E28 A32 G33 N34 I35 R38 R40 G41 T42 K43 F44 G53 R54 D55 F59 L61 F68 R76
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
PDBsum2zjp
PubMed18406324
UniProtQ9RY65|RL27_DEIRA Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]