Structure of PDB 2ykr Chain T

Receptor sequence

>2ykrT (length=85) Species: 668369 (Escherichia coli DH5[alpha])

NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

• PDB: 2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
• Chain: T
• Resolution: 9.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	N2 I3 K4 S5 A6 K7 K8 R9 I11 Q12 K15 R17 H19 R23 S25 M26 R28 T29 F30 K33 F50 Q54 P55 D58 R59 Q60 K63 K68 N69 K70 R73 K75 A76 T79	N1 I2 K3 S4 A5 K6 K7 R8 I10 Q11 K14 R16 H18 R22 S24 M25 R27 T28 F29 K32 F49 Q53 P54 D57 R58 Q59 K62 K67 N68 K69 R72 K74 A75 T78

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008073 ornithine decarboxylase inhibitor activity
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
• PDBsum: 2ykr
• PubMed: 21788480
• UniProt: P0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)