Structure of PDB 2otj Chain T

Receptor sequence

>2otjT (length=119) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEV
LRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTD
LDLEDEKREARLESEDDSA

3D structure

PDB

2otj The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	S1 K2 Q3 P4 D5 K6 Q7 R8 K9 Q11 R12 R13 L16 H17 H20 K21 R24 T26 R32 R38 N39 R41 N43 A44 R52 G53 D54 V65 L67 K69 L79 K81 T82 D83 V87 R89 S94 N95 R97 D105 K107 R111	S1 K2 Q3 P4 D5 K6 Q7 R8 K9 Q11 R12 R13 L16 H17 H20 K21 R24 T26 R32 R38 N39 R41 N43 A44 R52 G53 D54 V65 L67 K69 L79 K81 T82 D83 V87 R89 S94 N95 R97 D105 K107 R111	PDBbind-CN: Kd=2nM
BS02	MG	T	Q37 L112 S114	Q37 L112 S114

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2otj, PDBe:2otj, PDBj:2otj
PDBsum	2otj
PubMed	17321546
UniProt	P10972\|RL24_HALMA Large ribosomal subunit protein uL24 (Gene Name=rpl24)

[Back to BioLiP]