Structure of PDB 2f4v Chain T

Receptor sequence
>2f4vT (length=99) Species: 274 (Thermus thermophilus) [Search protein sequence]
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
3D structure
PDB2f4v Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
ChainT
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T L10 K14 R15 H16 R17 S19 R22 R23 R25 N26 A28 K29 S31 T35 K38 R57 E60 S61 D64 K65 K68 S70 K74 R79 K81 S82 R83 M85 R89 G102 G103 S105 L3 K7 R8 H9 R10 S12 R15 R16 R18 N19 A21 K22 S24 T28 K31 R50 E53 S54 D57 K58 K61 S63 K67 R72 K74 S75 R76 M78 R82 G95 G96 S98 PDBbind-CN: Kd=2.2uM
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f4v, PDBe:2f4v, PDBj:2f4v
PDBsum2f4v
PubMed16492561
UniProtP80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]