Structure of PDB 1vqk Chain T

Receptor sequence

>1vqkT (length=119) Species: 2238 (Haloarcula marismortui)

SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEV
LRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTD
LDLEDEKREARLESEDDSA

3D structure

• PDB: 1vqk Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
• Chain: T
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	S1 K2 Q3 P4 D5 K6 Q7 R8 K9 Q11 R12 R13 L16 H17 H20 K21 R24 T26 R32 R38 N39 R41 N43 A44 R52 G53 D54 L67 K69 L79 K81 T82 D83 V87 R89 D92 S94 N95 R97 D105 K107 R111 D116 D117	S1 K2 Q3 P4 D5 K6 Q7 R8 K9 Q11 R12 R13 L16 H17 H20 K21 R24 T26 R32 R38 N39 R41 N43 A44 R52 G53 D54 L67 K69 L79 K81 T82 D83 V87 R89 D92 S94 N95 R97 D105 K107 R111 D116 D117
BS02	MG	T	Q37 L112 S114	Q37 L112 S114

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1vqk, PDBe:1vqk, PDBj:1vqk
• PDBsum: 1vqk
• PubMed: 16285925
• UniProt: P10972|RL24_HALMA Large ribosomal subunit protein uL24 (Gene Name=rpl24)