Structure of PDB 1ibl Chain T

Receptor sequence

>1iblT (length=99) Species: 274 (Thermus thermophilus)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 1ibl Recognition of cognate transfer RNA by the 30S ribosomal subunit.
• Chain: T
• Resolution: 3.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	L10 K14 R15 H16 R17 S19 K21 R22 R23 R25 N26 K27 K29 S31 T35 K38 K39 E60 S61 D64 K65 K68 S70 K74 N75 A78 R79 K81 S82 R83 M85 R86 K87 R89 G102 G103 S105	L3 K7 R8 H9 R10 S12 K14 R15 R16 R18 N19 K20 K22 S24 T28 K31 K32 E53 S54 D57 K58 K61 S63 K67 N68 A71 R72 K74 S75 R76 M78 R79 K80 R82 G95 G96 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1ibl, PDBe:1ibl, PDBj:1ibl
• PDBsum: 1ibl
• PubMed: 11340196
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)