Structure of PDB 8xt2 Chain Sn

Receptor sequence

>8xt2Sn (length=69) Species: 9606 (Homo sapiens)

KNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIW
LKAGLKEAPEGWQTPKIYL

3D structure

• PDB: 8xt2 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Sn
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sn	F152 R155 E159	F25 R28 E32
BS02	rna	Sn	K128 N129 V130 K132 I133 R134 R135 R136 K137 M138 N139 H140 H141 K142 Y143 R144 K145 L146 V147 K148 R151 V157 R161 R164 K165 K171 R175 Y195	K1 N2 V3 K5 I6 R7 R8 R9 K10 M11 N12 H13 H14 K15 Y16 R17 K18 L19 V20 K21 R24 V30 R34 R37 K38 K44 R48 Y68

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0032543 mitochondrial translation
• GO:0045839 negative regulation of mitotic nuclear division
• GO:0045862 positive regulation of proteolysis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0043231 intracellular membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xt2, PDBe:8xt2, PDBj:8xt2
• PDBsum: 8xt2
• PubMed: 38942792
• UniProt: Q9NWT8|AKIP_HUMAN Small ribosomal subunit protein mS38 (Gene Name=AURKAIP1)