Structure of PDB 8k2a Chain Sj

Receptor sequence

>8k2aSj (length=201) Species: 9606 (Homo sapiens)

VRPRLIAELARRVRALREQLNRPRDSQLYAVDYETLTRPFSGRRLPVRAW
ADVRRESRLLQLLGRLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYT
AQNLDHGKAWGILTFKGKTESEAREIEHVMYHDWRLVPKHEEEAFTAFTA
SVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGR
A

3D structure

• PDB: 8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Sj
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Sj	R7 P8 R9 I11 A12 A15 V18 R19 L25 N26 Y34 R43 L50 P51 R53 D57 V58 L73 R99 V100 R101 Y104 M135 Y136 H137 D138 W201 K210 G211 R212	R2 P3 R4 I6 A7 A10 V13 R14 L20 N21 Y29 R38 L45 P46 R48 D52 V53 L68 R94 V95 R96 Y99 M130 Y131 H132 D133 W189 K198 G199 R200

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
• PDBsum: 8k2a
• PubMed: 38942792
• UniProt: P82930|RT34_HUMAN Small ribosomal subunit protein mS34 (Gene Name=MRPS34)