Structure of PDB 8bsj Chain Sj

Receptor sequence
>8bsjSj (length=67) Species: 5741 (Giardia intestinalis) [Search protein sequence]
RAHGGLTSAGKVRKCTPKKEKKEKPRPPRGRAYKRLLYNKNFVDDTLIHN
GRRLGPNNLLIRQKLGF
3D structure
PDB8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
ChainSj
Resolution6.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sj A2 S8 G10 K11 V12 R13 T16 K19 K21 K24 R26 P28 R29 R31 A32 N57 N58 L59 R62 F67 A2 S8 G10 K11 V12 R13 T16 K19 K21 K24 R26 P28 R29 R31 A32 N57 N58 L59 R62 F67
BS02 rna Sj R1 A2 R1 A2
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum8bsj
PubMed36912103
UniProtA0A644F843

[Back to BioLiP]