Structure of PDB 8bsi Chain Sj

Receptor sequence
>8bsiSj (length=64) Species: 5741 (Giardia intestinalis) [Search protein sequence]
RALTSAGKVRKCTPKKEKKEKPRPPRGRAYKRLLYNKNFVDDTLIHNGRR
LGPNNLLIRQKLGF
3D structure
PDB8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
ChainSj
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sj S8 G10 K11 V12 R13 C15 T16 K19 K21 K22 K24 R26 R29 G30 R31 R35 K40 P56 N57 N58 L59 R62 F67 S5 G7 K8 V9 R10 C12 T13 K16 K18 K19 K21 R23 R26 G27 R28 R32 K37 P53 N54 N55 L56 R59 F64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsi, PDBe:8bsi, PDBj:8bsi
PDBsum8bsi
PubMed36912103
UniProtA0A644F843

[Back to BioLiP]