Structure of PDB 8br8 Chain Sj

Receptor sequence
>8br8Sj (length=62) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]
GLTSAGKVRKCTPKKEKKEKPRPPRGRAYKRLLYNKNFVDDTLIHNGRRL
GPNNLLIRQKLG
3D structure
PDB8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
ChainSj
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Sj A9 G10 K11 V12 R13 C15 T16 K19 K21 K22 K24 R26 P28 R29 G30 R31 K34 R35 L37 P56 N57 N58 R62 A5 G6 K7 V8 R9 C11 T12 K15 K17 K18 K20 R22 P24 R25 G26 R27 K30 R31 L33 P52 N53 N54 R58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum8br8
PubMed36912103
UniProtA0A644F843

[Back to BioLiP]